PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID SapurV1A.1653s0040.2.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Salix
Family NAC
Protein Properties Length: 396aa    MW: 43707.4 Da    PI: 4.6883
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
SapurV1A.1653s0040.2.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM48.33.3e-15131246128
                     NAM   6 rFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp.kkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdke 91 
                             +F  +deel   +L +   g++l+  +vi++v+ y + P++Lp +  +  e+ wy           g ++n  t  g+Wk +g+  +
  SapurV1A.1653s0040.2.p  13 EFLCRDEELF-MFLDEVNIGSPLPG-NVITDVNPYIYAPSNLPdAPSNLPEDVWYLL---------GAKENDDTGVGFWKVKGEACK 88 
                             57789****9.99**********99.99***************33333333445444.........4445567899*********** PP

                     NAM  92 vlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                             ++s +++ +g ++tL f++g+ p+ +ktdWvm+ y +
  SapurV1A.1653s0040.2.p  89 LFS-NSTITGWRTTLNFFEGQVPHEHKTDWVMQKYWI 124
                             ***.999****************************75 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5100523.5398146IPR003441NAC domain
PfamPF023652.5E-713122IPR003441NAC domain
SuperFamilySSF1019417.32E-2214145IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 396 aa     Download sequence    Send to blast
MCPPASSPVA DIEFLCRDEE LFMFLDEVNI GSPLPGNVIT DVNPYIYAPS NLPDAPSNLP  60
EDVWYLLGAK ENDDTGVGFW KVKGEACKLF SNSTITGWRT TLNFFEGQVP HEHKTDWVMQ  120
KYWITKAQSG KSKAKEASSL CRVFYGGEQA LDHENQLIAS LHSDTHIDLT LSIGPGTPAD  180
TSHGSSSNPE VNKDDETEKV VVTGRHPNLP VPNPPETDYF FGGDYLELLD LDNPASRSSS  240
SDNSSCMTMS SDEYFDSIAL LQDIESEINQ GSTRKDKDCK LSVTASLRPD EVVMLPASQG  300
SYISIEGGKP HADKTDSSMR DNGHKDLDIQ RAIRNQDENH LDEGSTSNFH AVGSSSGGRV  360
SSPDGEEKAA KRTRKKLRNK YLRNKYLCFV PFYFF*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1371377RTRKKLR
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEF1466750.0EF146675.1 Populus trichocarpa clone WS01211_M01 unknown mRNA.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006375066.10.0hypothetical protein POPTR_0014s04080g
TrEMBLU5FNU90.0U5FNU9_POPTR; Uncharacterized protein
STRINGPOPTR_0014s04080.10.0(Populus trichocarpa)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G65910.19e-16NAC domain containing protein 28